Plant Transcription Factor Database
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pp3c2_10790V3.1.p
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Bryophyta; Bryophytina; Bryopsida; Funariidae; Funariales; Funariaceae; Physcomitrella
Family HD-ZIP
Protein Properties Length: 795aa    MW: 86984.2 Da    PI: 6.5216
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pp3c2_10790V3.1.pgenomeCOSMOSSView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
           Homeobox   1 rrkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                        +++ +++t+ q++e+e lF+++++p+ ++r++L+k lgL+ rqVk+WFqNrR+ +k
                        688999**********************************************9988 PP

              START   2 laeeaaqelvkkalaeepgWvkss....esengdevlqkfeeskv.....dsgealrasgvvdmvlallveellddkeqWdetla....kae 80 
                        la  a++elv++a++eep+Wv+ +    e++n+de+l++ +++ +      ++e+ r++++v m+ ++lve+l+d   qW  +++    +a 
                        566799************************************999********************************.************** PP

              START  81 tlevissg......galqlmvaelqalsplvp.RdfvfvRyirqlgagdwvivdvSvdseqkppesssvvRaellpSgiliepksnghskvt 165
                        t++v+s+g      galqlm+aelq+lsplvp R+ +f+Ry++q+ +g+w++vdvSv+s +++p  +s++R++++pSgili++++ng+ kvt
                        ****************************************************************.7************************** PP

              START 166 wvehvdlkgrlphwllrslvksglaegaktwvatlqrqcek 206
                         veh+++++r +h ++r lv+sg+a+ga++w+atlqrqce+
                        ***************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.908103163IPR001356Homeobox domain
SMARTSM003897.3E-20104167IPR001356Homeobox domain
PfamPF000464.9E-19106161IPR001356Homeobox domain
CDDcd000866.11E-19106163No hitNo description
PROSITE patternPS000270138161IPR017970Homeobox, conserved site
PROSITE profilePS5084847.171294529IPR002913START domain
SuperFamilySSF559614.03E-37295528No hitNo description
CDDcd088752.46E-128298525No hitNo description
SMARTSM002341.9E-60303526IPR002913START domain
PfamPF018527.8E-56305526IPR002913START domain
Gene3DG3DSA:3.30.530.207.0E-6400526IPR023393START-like domain
SuperFamilySSF559612.2E-24549786No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0008289Molecular Functionlipid binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 795 aa     Download sequence    Send to blast
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002988402.10.0hypothetical protein SELMODRAFT_450553
SwissprotQ93V990.0PDF2_ARATH; Homeobox-leucine zipper protein PROTODERMAL FACTOR 2
TrEMBLQ147S50.0Q147S5_PHYPA; Class IV HD-Zip protein HDZ42
STRINGPP1S84_236V6.10.0(Physcomitrella patens)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
Representative plantOGRP14515136
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G04890.10.0protodermal factor 2
Publications ? help Back to Top
  1. Prigge MJ,Clark SE
    Evolution of the class III HD-Zip gene family in land plants.
    Evol. Dev., 2006 Jul-Aug. 8(4): p. 350-61